SCOPe 2.08: Domain d3ltyb_: 3lty B:

Lineage for d3ltyb_ (3lty B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein automated matches [190130] (11 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:187420] [188934] (67 PDB entries)

8. Domain d3ltyb_: 3lty B: [180572]
   automated match to d1dv7a_
   complexed with bmp; mutant

Details for d3ltyb_

PDB Entry: 3lty, 1.5 Å

PDB Description: crystal structure of the mutant v182a,i218a of orotidine 5'- monophosphate decarboxylase from methanobacterium thermoautotrophicum complexed with inhibitor bmp

PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3ltyb_:

Sequence; same for both SEQRES and ATOM records:

>d3ltyb_ c.1.2.3 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 187420]}
dvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcriia
dfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemshp
gaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgagaqggdp
getlrfadaiivgrsiyladnpaaaaagaiesi

Timeline for d3ltyb_:

• d3ltyb_ first appeared in SCOPe 2.01
  
• d3ltyb_ appears in SCOPe 2.07