Lineage for d3ltvd_ (3ltv D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936733Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 936734Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 936747Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 937073Species Mouse (Mus musculus) [TaxId:10090] [189448] (2 PDB entries)
  8. 937078Domain d3ltvd_: 3ltv D: [180567]
    automated match to d1hl4a_
    complexed with zn

Details for d3ltvd_

PDB Entry: 3ltv (more details), 2.45 Å

PDB Description: mouse-human sod1 chimera
PDB Compounds: (D:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3ltvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ltvd_ b.1.8.1 (D:) Cu,Zn superoxide dismutase, SOD {Mouse (Mus musculus) [TaxId: 10090]}
amkavcvlkgdgpvqgtihfeqkasgepvvlsgqitgltegqhgfhvhqygdntqgctsa
gphfnphskkhggpadeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
ekaddlgkggneestktgnagsrlacgvigia

SCOPe Domain Coordinates for d3ltvd_:

Click to download the PDB-style file with coordinates for d3ltvd_.
(The format of our PDB-style files is described here.)

Timeline for d3ltvd_: