| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) ![]() contains one classic and one pseudo HhH motifs |
| Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
| Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
| Species Human (Homo sapiens) [TaxId:9606] [47805] (145 PDB entries) Uniprot P06746 |
| Domain d7icua1: 7icu A:9-91 [18056] Other proteins in same PDB: d7icua3, d7icua4 protein/DNA complex; complexed with cd, na |
PDB Entry: 7icu (more details), 3.3 Å
SCOPe Domain Sequences for d7icua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7icua1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd
Timeline for d7icua1: