SCOPe 2.06: Domain d3ltlb_: 3ltl B:

Lineage for d3ltlb_ (3ltl B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.3: Sec7 domain [48425] (2 families)

5. Family a.118.3.0: automated matches [191673] (1 protein)
   not a true family

6. Protein automated matches [191283] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189904] (8 PDB entries)

8. Domain d3ltlb_: 3ltl B: [180558]
   automated match to d1bc9a_
   complexed with acy, ca

Details for d3ltlb_

PDB Entry: 3ltl, 2.2 Å

PDB Description: Crystal structure of human BIG1 Sec7 domain

PDB Compounds: (B:) Brefeldin A-inhibited guanine nucleotide-exchange protein 1

SCOPe Domain Sequences for d3ltlb_:

Sequence; same for both SEQRES and ATOM records:

>d3ltlb_ a.118.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eiieqgidlfnkkpkrgiqylqeqgmlgttpediaqflhqeerldstqvgeflgdndkfn
kevmyayvdqhdfsgkdfvsalrmflegfrlpgeaqkidrlmekfaarylecnqgqtlfa
sadtayvlaysiimlttdlhspqvknkmtkeqyikmnrgindskdlpeeylsaiyneiag
kkismk

Timeline for d3ltlb_:

• d3ltlb_ first appeared in SCOPe 2.01
  
• d3ltlb_ appears in SCOPe 2.05
  
• d3ltlb_ appears in SCOPe 2.07
  
• d3ltlb_ appears in the current release, SCOPe 2.08