Lineage for d3ltlb_ (3ltl B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726245Superfamily a.118.3: Sec7 domain [48425] (2 families) (S)
  5. 2726283Family a.118.3.0: automated matches [191673] (1 protein)
    not a true family
  6. 2726284Protein automated matches [191283] (3 species)
    not a true protein
  7. 2726288Species Human (Homo sapiens) [TaxId:9606] [189904] (8 PDB entries)
  8. 2726294Domain d3ltlb_: 3ltl B: [180558]
    automated match to d1bc9a_
    complexed with acy, ca

Details for d3ltlb_

PDB Entry: 3ltl (more details), 2.2 Å

PDB Description: Crystal structure of human BIG1 Sec7 domain
PDB Compounds: (B:) Brefeldin A-inhibited guanine nucleotide-exchange protein 1

SCOPe Domain Sequences for d3ltlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ltlb_ a.118.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eiieqgidlfnkkpkrgiqylqeqgmlgttpediaqflhqeerldstqvgeflgdndkfn
kevmyayvdqhdfsgkdfvsalrmflegfrlpgeaqkidrlmekfaarylecnqgqtlfa
sadtayvlaysiimlttdlhspqvknkmtkeqyikmnrgindskdlpeeylsaiyneiag
kkismk

SCOPe Domain Coordinates for d3ltlb_:

Click to download the PDB-style file with coordinates for d3ltlb_.
(The format of our PDB-style files is described here.)

Timeline for d3ltlb_: