![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.3: Sec7 domain [48425] (2 families) ![]() |
![]() | Family a.118.3.0: automated matches [191673] (1 protein) not a true family |
![]() | Protein automated matches [191283] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189904] (8 PDB entries) |
![]() | Domain d3ltlb_: 3ltl B: [180558] automated match to d1bc9a_ complexed with acy, ca |
PDB Entry: 3ltl (more details), 2.2 Å
SCOPe Domain Sequences for d3ltlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ltlb_ a.118.3.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eiieqgidlfnkkpkrgiqylqeqgmlgttpediaqflhqeerldstqvgeflgdndkfn kevmyayvdqhdfsgkdfvsalrmflegfrlpgeaqkidrlmekfaarylecnqgqtlfa sadtayvlaysiimlttdlhspqvknkmtkeqyikmnrgindskdlpeeylsaiyneiag kkismk
Timeline for d3ltlb_: