SCOPe 2.06: Domain d3lswa_: 3lsw A:

Lineage for d3lswa_ (3lsw A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)

6. Protein automated matches [190140] (30 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189278] (37 PDB entries)

8. Domain d3lswa_: 3lsw A: [180544]
   automated match to d1ftja_
   complexed with 4mp, glu, zn

Details for d3lswa_

PDB Entry: 3lsw, 1.75 Å

PDB Description: aniracetam bound to the ligand binding domain of glua3

PDB Compounds: (A:) GluA2 S1S2 domain

SCOPe Domain Sequences for d3lswa_:

Sequence; same for both SEQRES and ATOM records:

>d3lswa_ c.94.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
rtivvttilespyvmykknheqlegneryegycvdlayeiakhvrikyklsivgdgkyga
rdpetkiwngmvgelvygradiavapltitlvreevidfskpfmslgisimikkgtpies
aedlakqteiaygtldsgstkeffrrskiavyekmwsymksaepsvftkttadgvarvrk
skgkfafllestmneyieqrkpcdtmkvggnldskgygvatpkgsalgtpvnlavlklse
qgildklknkwwydkgec

Timeline for d3lswa_:

• d3lswa_ first appeared in SCOPe 2.01
  
• d3lswa_ appears in SCOPe 2.05
  
• d3lswa_ appears in SCOPe 2.07
  
• d3lswa_ appears in the current release, SCOPe 2.08