SCOPe 2.02: Domain d3lsfe_: 3lsf E:

Lineage for d3lsfe_ (3lsf E:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (104 PDB entries)

8. Domain d3lsfe_: 3lsf E: [180542]
   automated match to d1ftja_
   complexed with glu, pzi, zn

Details for d3lsfe_

PDB Entry: 3lsf, 1.85 Å

PDB Description: piracetam bound to the ligand binding domain of glua2

PDB Compounds: (E:) Glutamate receptor 2

SCOPe Domain Sequences for d3lsfe_:

Sequence; same for both SEQRES and ATOM records:

>d3lsfe_ c.94.1.1 (E:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgnavnlavlklse
qglldklknkwwydkgec

Timeline for d3lsfe_:

• d3lsfe_ first appeared in SCOPe 2.01
  
• d3lsfe_ appears in SCOPe 2.03
  
• d3lsfe_ appears in the current release, SCOPe 2.08