![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (11 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187655] (21 PDB entries) |
![]() | Domain d3lsea_: 3lse A: [180540] automated match to d1a3ka_ complexed with lat |
PDB Entry: 3lse (more details), 2.69 Å
SCOPe Domain Sequences for d3lsea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lsea_ b.29.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sqapylspavpfsgtiqgglqdglqitvngtvlsssgtrfavnfqtgfsgndiafhfnpr fedggyvvcntrqngswgpeerkthmpfqkgmpfdlcflvqssdfkvmvngilfvqyfhr vpfhrvdtisvngsvqlsyisfq
Timeline for d3lsea_: