Lineage for d3ls6b_ (3ls6 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1038807Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 1038808Superfamily d.115.1: YrdC/RibB [55821] (3 families) (S)
  5. 1038821Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
    contains one additional helix in the C-terminal extension
  6. 1038848Protein automated matches [190415] (3 species)
    not a true protein
  7. 1038849Species Salmonella typhimurium [TaxId:90371] [189463] (3 PDB entries)
  8. 1038851Domain d3ls6b_: 3ls6 B: [180538]
    automated match to d1ieza_
    complexed with gol, mg, so4, zn

Details for d3ls6b_

PDB Entry: 3ls6 (more details), 1.86 Å

PDB Description: Crystal structure of 3,4-Dihydroxy-2-butanone 4-phosphate synthase in complex with sulfate and zinc
PDB Compounds: (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d3ls6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ls6b_ d.115.1.2 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
gtpfervelaldalregrgvmvlddedrenegdmifpaetmtveqmaltirhgsgivclc
itedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrvttvraaikdgakps
dlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarapeci
afagqhnmavvtiedlvayrqah

SCOPe Domain Coordinates for d3ls6b_:

Click to download the PDB-style file with coordinates for d3ls6b_.
(The format of our PDB-style files is described here.)

Timeline for d3ls6b_: