SCOPe 2.08: Domain d3ls6b_: 3ls6 B:

Lineage for d3ls6b_ (3ls6 B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.115: YrdC/RibB [55820] (1 superfamily)
   core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other

4. Superfamily d.115.1: YrdC/RibB [55821] (3 families)

5. Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
   contains one additional helix in the C-terminal extension
   automatically mapped to Pfam PF00926

6. Protein automated matches [190415] (4 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [189463] (3 PDB entries)

8. Domain d3ls6b_: 3ls6 B: [180538]
   automated match to d1ieza_
   complexed with gol, mg, so4, zn

Details for d3ls6b_

PDB Entry: 3ls6, 1.86 Å

PDB Description: Crystal structure of 3,4-Dihydroxy-2-butanone 4-phosphate synthase in complex with sulfate and zinc

PDB Compounds: (B:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d3ls6b_:

Sequence; same for both SEQRES and ATOM records:

>d3ls6b_ d.115.1.2 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
gtpfervelaldalregrgvmvlddedrenegdmifpaetmtveqmaltirhgsgivclc
itedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrvttvraaikdgakps
dlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarapeci
afagqhnmavvtiedlvayrqah

Timeline for d3ls6b_:

• d3ls6b_ first appeared in SCOPe 2.01
  
• d3ls6b_ appears in SCOPe 2.07