Lineage for d3lrjc_ (3lrj C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971984Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 2971985Superfamily d.115.1: YrdC/RibB [55821] (3 families) (S)
  5. 2972000Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
    contains one additional helix in the C-terminal extension
    automatically mapped to Pfam PF00926
  6. 2972027Protein automated matches [190415] (4 species)
    not a true protein
  7. 2972028Species Salmonella typhimurium [TaxId:90371] [189463] (3 PDB entries)
  8. 2972035Domain d3lrjc_: 3lrj C: [180530]
    automated match to d1ieza_
    complexed with so4

Details for d3lrjc_

PDB Entry: 3lrj (more details), 2.8 Å

PDB Description: crystal structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase in complex with sulfate ion.
PDB Compounds: (C:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d3lrjc_:

Sequence, based on SEQRES records: (download)

>d3lrjc_ d.115.1.2 (C:) automated matches {Salmonella typhimurium [TaxId: 90371]}
fgtpfervelaldalregrgvmvlddedrenegdmifpaetmtveqmaltirhgsgivcl
citedrrkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrvttvraaikdgakp
sdlnrpghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarapec
iafagqhnmavvtiedlvayrqah

Sequence, based on observed residues (ATOM records): (download)

>d3lrjc_ d.115.1.2 (C:) automated matches {Salmonella typhimurium [TaxId: 90371]}
fgtpfervelaldalregrgvmvldegdmifpaetmtveqmaltirhgsgivclcitedr
rkqldlpmmvenntsaygtgftvtieaaegvttgvsaadrvttvraaikdgakpsdlnrp
ghvfplraqaggvltrgghteatidlmtlagfkpagvlceltnddgtmarapeciafagq
hnmavvtiedlvayrqah

SCOPe Domain Coordinates for d3lrjc_:

Click to download the PDB-style file with coordinates for d3lrjc_.
(The format of our PDB-style files is described here.)

Timeline for d3lrjc_: