SCOPe 2.08: Domain d3lqxa1: 3lqx A:1-80

Lineage for d3lqxa1 (3lqx A:1-80)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.36: Signal peptide-binding domain [47445] (1 superfamily)
   4 helices; orthogonal array

4. Superfamily a.36.1: Signal peptide-binding domain [47446] (2 families)

5. Family a.36.1.1: Signal peptide-binding domain [47447] (2 proteins)

6. Protein Signal sequence binding protein Ffh [47448] (3 species)

7. Species Escherichia coli [TaxId:562] [47449] (14 PDB entries)

8. Domain d3lqxa1: 3lqx A:1-80 [180521]
   Other proteins in same PDB: d3lqxa2
   automated match to d1hq1a_
   protein/RNA complex; complexed with cl, k, nco

Details for d3lqxa1

PDB Entry: 3lqx, 1.93 Å

PDB Description: SRP ribonucleoprotein core complexed with cobalt hexammine

PDB Compounds: (A:) signal recognition particle protein

SCOPe Domain Sequences for d3lqxa1:

Sequence, based on SEQRES records:

>d3lqxa1 a.36.1.1 (A:1-80) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
fdlndfleqlrqmknmggmaslmgklpgmgqipdnvksqmddkvlvrmeaiinsmtmker
akpeiikgsrkrriaagsgmqvqdvnrllkqfddmqrmmk

Sequence, based on observed residues (ATOM records):

>d3lqxa1 a.36.1.1 (A:1-80) Signal sequence binding protein Ffh {Escherichia coli [TaxId: 562]}
fdlndfleqkvlvrmeaiinsmtmkerakpeiikgsrkrriaagsgmqvqdvnrllkqfd
dmqrmmk

Timeline for d3lqxa1:

• d3lqxa1 first appeared in SCOPe 2.01, called d3lqxa_
  
• d3lqxa1 appears in SCOPe 2.07