Lineage for d3lqvb_ (3lqv B:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1652149Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1652150Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1652591Protein automated matches [190332] (3 species)
    not a true protein
  7. 1652596Species Human (Homo sapiens) [TaxId:9606] [187155] (22 PDB entries)
  8. 1652632Domain d3lqvb_: 3lqv B: [180520]
    automated match to d2f9da1
    complexed with ade

Details for d3lqvb_

PDB Entry: 3lqv (more details), 2.38 Å

PDB Description: branch recognition by sf3b14
PDB Compounds: (B:) Pre-mRNA branch site protein p14

SCOPe Domain Sequences for d3lqvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lqvb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
irlppevnrilyirnlpykitaeemydifgkygpirqirvgntpetrgtayvvyedifda
knavdhlsgfnvsnrylvvlyynanrafqkmdtkkkeeqlkllkekygintdppk

SCOPe Domain Coordinates for d3lqvb_:

Click to download the PDB-style file with coordinates for d3lqvb_.
(The format of our PDB-style files is described here.)

Timeline for d3lqvb_: