SCOPe 2.01: Domain d3lqsa_: 3lqs A:

Lineage for d3lqsa_ (3lqs A:)

1. Root: SCOPe 2.01

2. Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)

3. Fold e.17: D-aminoacid aminotransferase-like PLP-dependent enzymes [56751] (1 superfamily)
   2 domains: (1) alpha+beta: beta3-alpha2-beta2; (2) alpha/beta, a part of its mixed sheet forms barrel: n=6, S=8

4. Superfamily e.17.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56752] (2 families)

5. Family e.17.1.1: D-aminoacid aminotransferase-like PLP-dependent enzymes [56753] (4 proteins)

6. Protein D-aminoacid aminotransferase [56754] (2 species)

7. Species Bacillus sp., strain YM-1 [TaxId:1409] [56755] (8 PDB entries)
   domain 1: 1-120; domain 2: 121-277

8. Domain d3lqsa_: 3lqs A: [180515]
   automated match to d1a0ga_
   complexed with acy, psz

Details for d3lqsa_

PDB Entry: 3lqs, 1.9 Å

PDB Description: complex structure of d-amino acid aminotransferase and 4-amino-4,5- dihydro-thiophenecarboxylic acid (adta)

PDB Compounds: (A:) d-alanine aminotransferase

SCOPe Domain Sequences for d3lqsa_:

Sequence; same for both SEQRES and ATOM records:

>d3lqsa_ e.17.1.1 (A:) D-aminoacid aminotransferase {Bacillus sp., strain YM-1 [TaxId: 1409]}
gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
ttseitpvieidgklirdgkvgewtrklqkqfetkipkpl

Timeline for d3lqsa_:

• d3lqsa_ is new in SCOPe 2.01-stable
  
• d3lqsa_ appears in SCOPe 2.02
  
• d3lqsa_ appears in the current release, SCOPe 2.08