SCOPe 2.06: Domain d3lqfc_: 3lqf C:

Lineage for d3lqfc_ (3lqf C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [189314] (2 PDB entries)

8. Domain d3lqfc_: 3lqf C: [180510]
   automated match to d1vl8b_
   complexed with mg, mry, nad

Details for d3lqfc_

PDB Entry: 3lqf, 1.8 Å

PDB Description: Crystal structure of the short-chain dehydrogenase Galactitol-Dehydrogenase (GatDH) of Rhodobacter sphaeroides in complex with NAD and erythritol

PDB Compounds: (C:) Galactitol dehydrogenase

SCOPe Domain Sequences for d3lqfc_:

Sequence; same for both SEQRES and ATOM records:

>d3lqfc_ c.2.1.0 (C:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mdyrtvfrldgacaavtgagsgigleicrafaasgarlilidreaaaldraaqelgaava
arivadvtdaeamtaaaaeaeavapvsilvnsagiarlhdaletddatwrqvmavnvdgm
fwasrafgramvargagaivnlgsmsgtivnrpqfassymaskgavhqltralaaewagr
gvrvnalapgyvatemtlkmrerpelfetwldmtpmgrcgepseiaaaalflaspaasyv
tgailavdggytvw

Timeline for d3lqfc_:

• d3lqfc_ first appeared in SCOPe 2.01
  
• d3lqfc_ appears in SCOPe 2.05
  
• d3lqfc_ appears in SCOPe 2.07
  
• d3lqfc_ appears in the current release, SCOPe 2.08