Lineage for d3lqfa_ (3lqf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848346Species Rhodobacter sphaeroides [TaxId:1063] [189314] (3 PDB entries)
  8. 2848351Domain d3lqfa_: 3lqf A: [180508]
    automated match to d1vl8b_
    complexed with mg, mry, nad

Details for d3lqfa_

PDB Entry: 3lqf (more details), 1.8 Å

PDB Description: Crystal structure of the short-chain dehydrogenase Galactitol-Dehydrogenase (GatDH) of Rhodobacter sphaeroides in complex with NAD and erythritol
PDB Compounds: (A:) Galactitol dehydrogenase

SCOPe Domain Sequences for d3lqfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lqfa_ c.2.1.0 (A:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
mdyrtvfrldgacaavtgagsgigleicrafaasgarlilidreaaaldraaqelgaava
arivadvtdaeamtaaaaeaeavapvsilvnsagiarlhdaletddatwrqvmavnvdgm
fwasrafgramvargagaivnlgsmsgtivnrpqfassymaskgavhqltralaaewagr
gvrvnalapgyvatemtlkmrerpelfetwldmtpmgrcgepseiaaaalflaspaasyv
tgailavdggytvw

SCOPe Domain Coordinates for d3lqfa_:

Click to download the PDB-style file with coordinates for d3lqfa_.
(The format of our PDB-style files is described here.)

Timeline for d3lqfa_: