![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein automated matches [190359] (43 species) not a true protein |
![]() | Species Lepus europaeus [TaxId:9983] [189630] (1 PDB entry) |
![]() | Domain d3lqdd_: 3lqd D: [180507] automated match to d1aj9b_ complexed with hem, oxy |
PDB Entry: 3lqd (more details), 2.8 Å
SCOPe Domain Sequences for d3lqdd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lqdd_ a.1.1.2 (D:) automated matches {Lepus europaeus [TaxId: 9983]} vhlsgeeksavtalwgkvnveevggetlgrllvvypwtqrffesfgdlstasavmgnpkv kahgkkvlaafseglshldnlkgtfaklselhcdklhvdpenfrllgnvlvivlshhfgk eftpqvqaayqkvvagvanalahkyh
Timeline for d3lqdd_: