| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (44 species) not a true protein |
| Species Lepus europaeus [TaxId:9983] [189630] (1 PDB entry) |
| Domain d3lqdb_: 3lqd B: [180506] automated match to d1aj9b_ complexed with hem, oxy |
PDB Entry: 3lqd (more details), 2.8 Å
SCOPe Domain Sequences for d3lqdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lqdb_ a.1.1.2 (B:) automated matches {Lepus europaeus [TaxId: 9983]}
vhlsgeeksavtalwgkvnveevggetlgrllvvypwtqrffesfgdlstasavmgnpkv
kahgkkvlaafseglshldnlkgtfaklselhcdklhvdpenfrllgnvlvivlshhfgk
eftpqvqaayqkvvagvanalahkyh
Timeline for d3lqdb_: