Lineage for d3lqdb_ (3lqd B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301856Protein automated matches [190359] (44 species)
    not a true protein
  7. 2302178Species Lepus europaeus [TaxId:9983] [189630] (1 PDB entry)
  8. 2302180Domain d3lqdb_: 3lqd B: [180506]
    automated match to d1aj9b_
    complexed with hem, oxy

Details for d3lqdb_

PDB Entry: 3lqd (more details), 2.8 Å

PDB Description: Crystal structure determination of Lepus europaeus 2.8 A resolution
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3lqdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lqdb_ a.1.1.2 (B:) automated matches {Lepus europaeus [TaxId: 9983]}
vhlsgeeksavtalwgkvnveevggetlgrllvvypwtqrffesfgdlstasavmgnpkv
kahgkkvlaafseglshldnlkgtfaklselhcdklhvdpenfrllgnvlvivlshhfgk
eftpqvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d3lqdb_:

Click to download the PDB-style file with coordinates for d3lqdb_.
(The format of our PDB-style files is described here.)

Timeline for d3lqdb_: