Lineage for d3lqda_ (3lqd A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688722Species Lepus europaeus [TaxId:9983] [189630] (1 PDB entry)
  8. 2688723Domain d3lqda_: 3lqd A: [180505]
    automated match to d1bz1a_
    complexed with hem, oxy

Details for d3lqda_

PDB Entry: 3lqd (more details), 2.8 Å

PDB Description: Crystal structure determination of Lepus europaeus 2.8 A resolution
PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3lqda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lqda_ a.1.1.2 (A:) automated matches {Lepus europaeus [TaxId: 9983]}
vlspadktniktawekigshggeygaeavermflgfpttktyfphfdfthgseqikahgk
kvsealtkavghlddlpgalsalsdlhahklrvdpvnfkllshcllvtlanhhpseftpa
vhasldkflanvstvltskyr

SCOPe Domain Coordinates for d3lqda_:

Click to download the PDB-style file with coordinates for d3lqda_.
(The format of our PDB-style files is described here.)

Timeline for d3lqda_: