SCOPe 2.05: Domain d3lpyb_: 3lpy B:

Lineage for d3lpyb_ (3lpy B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (68 proteins)

6. Protein automated matches [190332] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (24 PDB entries)

8. Domain d3lpyb_: 3lpy B: [180504]
   automated match to d2cqba1
   complexed with epe, so4

Details for d3lpyb_

PDB Entry: 3lpy, 2 Å

PDB Description: Crystal structure of the RRM domain of CyP33

PDB Compounds: (B:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d3lpyb_:

Sequence; same for both SEQRES and ATOM records:

>d3lpyb_ d.58.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaedaaaa
idnmneselfgrtirvnla

Timeline for d3lpyb_:

• d3lpyb_ first appeared in SCOPe 2.01
  
• d3lpyb_ appears in SCOPe 2.04
  
• d3lpyb_ is called d3lpyb1 in SCOPe 2.06
  
• d3lpyb_ appears in the current release, SCOPe 2.08, called d3lpyb1