![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein automated matches [190332] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries) |
![]() | Domain d3lpyb1: 3lpy B:5-82 [180504] Other proteins in same PDB: d3lpya2, d3lpyb2 automated match to d2cqba1 complexed with epe, so4 |
PDB Entry: 3lpy (more details), 2 Å
SCOPe Domain Sequences for d3lpyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lpyb1 d.58.7.1 (B:5-82) automated matches {Human (Homo sapiens) [TaxId: 9606]} krvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaedaaaai dnmneselfgrtirvnla
Timeline for d3lpyb1: