SCOPe 2.08: Domain d3lpyb1: 3lpy B:5-82

Lineage for d3lpyb1 (3lpy B:5-82)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries)

8. Domain d3lpyb1: 3lpy B:5-82 [180504]
   Other proteins in same PDB: d3lpya2, d3lpyb2
   automated match to d2cqba1
   complexed with epe, so4

Details for d3lpyb1

PDB Entry: 3lpy, 2 Å

PDB Description: Crystal structure of the RRM domain of CyP33

PDB Compounds: (B:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d3lpyb1:

Sequence; same for both SEQRES and ATOM records:

>d3lpyb1 d.58.7.1 (B:5-82) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaedaaaai
dnmneselfgrtirvnla

Timeline for d3lpyb1:

• d3lpyb1 first appeared in SCOPe 2.01, called d3lpyb_
  
• d3lpyb1 appears in SCOPe 2.07