Lineage for d3lpya_ (3lpy A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908891Protein automated matches [190332] (4 species)
    not a true protein
  7. 1908892Species Human (Homo sapiens) [TaxId:9606] [187155] (24 PDB entries)
  8. 1908918Domain d3lpya_: 3lpy A: [180503]
    automated match to d2cqba1
    complexed with epe, so4

Details for d3lpya_

PDB Entry: 3lpy (more details), 2 Å

PDB Description: Crystal structure of the RRM domain of CyP33
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d3lpya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lpya_ d.58.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaedaaaa
idnmneselfgrtirvnla

SCOPe Domain Coordinates for d3lpya_:

Click to download the PDB-style file with coordinates for d3lpya_.
(The format of our PDB-style files is described here.)

Timeline for d3lpya_: