SCOPe 2.07: Domain d3lpua_: 3lpu A:

Lineage for d3lpua_ (3lpu A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein automated matches [190209] (5 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [186963] (69 PDB entries)

8. Domain d3lpua_: 3lpu A: [180500]
   automated match to d1bi4c_
   complexed with 976, ca, p03, peg, so4

Details for d3lpua_

PDB Entry: 3lpu, 1.95 Å

PDB Description: hiv integrase

PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d3lpua_:

Sequence, based on SEQRES records:

>d3lpua_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
dcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvh
tdngsnftsttvkaacwwagikqefgipynpqsqgviesmnkelkkiigqvrdqaehlkt
avqmavfihnkkrkggiggysagerivdiiatdiq

Sequence, based on observed residues (ATOM records):

>d3lpua_ c.55.3.2 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
dcspgiwqldcthlegkvilvavhvasgyieaevipaetgqetayfllklagrwpvktvh
tdngsnftsttvkaacwwagikqefgipynpsmnkelkkiigqvrdqaehlktavqmavf
ihnkkrkgysagerivdiiatdiq

Timeline for d3lpua_:

• d3lpua_ first appeared in SCOPe 2.01
  
• d3lpua_ appears in SCOPe 2.06
  
• d3lpua_ appears in the current release, SCOPe 2.08