Lineage for d9icya1 (9icy A:9-91)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.60: SAM domain-like [47768] (10 superfamilies) 
Superfamily a.60.6: DNA polymerase beta, N-terminal (8 kD)-domain [47802] (1 family) 
Family a.60.6.1: DNA polymerase beta, N-terminal (8 kD)-domain [47803] (1 protein) Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) Species Human (Homo sapiens) [TaxId:9606] [47805] (90 PDB entries) 
Domain d9icya1: 9icy A:9-91 [18050]
Other proteins in same PDB: d9icya2
Details for d9icya1
PDB Entry: 9icy (more details), 3 Å
PDB Description: dna polymerase beta (e.c.2.7.7.7) complexed with seven base pairs of dna (non gapped dna only)
SCOP Domain Sequences for d9icya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d9icya1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens)}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd
SCOP Domain Coordinates for d9icya1:
Click to download the PDB-style file with coordinates for d9icya1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d9icya1:
- d9icya1 appears in SCOP 1.57
- d9icya1 appears in the current release, SCOPe 2.08
View in 3D
