Lineage for d3lpef_ (3lpe F:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641934Superfamily g.41.9: RNA polymerase subunits [63393] (3 families) (S)
  5. 2641990Family g.41.9.0: automated matches [191622] (1 protein)
    not a true family
  6. 2641991Protein automated matches [191140] (4 species)
    not a true protein
  7. 2641994Species Methanocaldococcus jannaschii [TaxId:2190] [189266] (1 PDB entry)
  8. 2641997Domain d3lpef_: 3lpe F: [180497]
    automated match to d1ryqa_
    protein/DNA complex; protein/RNA complex; complexed with zn

Details for d3lpef_

PDB Entry: 3lpe (more details), 1.9 Å

PDB Description: crystal structure of spt4/5ngn heterodimer complex from methanococcus jannaschii
PDB Compounds: (F:) DNA-directed RNA polymerase subunit E''

SCOPe Domain Sequences for d3lpef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lpef_ g.41.9.0 (F:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
mraclkckyltndeicpichsptsenwigllivinpekseiakkagidikgkyalsvke

SCOPe Domain Coordinates for d3lpef_:

Click to download the PDB-style file with coordinates for d3lpef_.
(The format of our PDB-style files is described here.)

Timeline for d3lpef_: