Class g: Small proteins [56992] (92 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.9: RNA polymerase subunits [63393] (3 families) |
Family g.41.9.0: automated matches [191622] (1 protein) not a true family |
Protein automated matches [191140] (1 species) not a true protein |
Species Methanocaldococcus jannaschii [TaxId:2190] [189266] (1 PDB entry) |
Domain d3lped_: 3lpe D: [180496] automated match to d1ryqa_ protein/DNA complex; protein/RNA complex; complexed with zn |
PDB Entry: 3lpe (more details), 1.9 Å
SCOPe Domain Sequences for d3lped_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lped_ g.41.9.0 (D:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} mraclkckyltndeicpichsptsenwigllivinpekseiakkagidikgkyalsvke
Timeline for d3lped_: