![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Hypothetical transcriptional regulator YcdC [88973] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [88974] (4 PDB entries) |
![]() | Domain d3locd1: 3loc D:11-85 [180471] Other proteins in same PDB: d3loca2, d3locb2, d3locc2, d3locd2 complexed with ura |
PDB Entry: 3loc (more details), 2.5 Å
SCOPe Domain Sequences for d3locd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3locd1 a.4.1.9 (D:11-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]} rsravsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlr qildiwlaplkafre
Timeline for d3locd1: