Lineage for d3lo3z_ (3lo3 Z:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906842Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1907207Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 1907208Protein automated matches [190081] (21 species)
    not a true protein
  7. 1907248Species Colwellia psychrerythraea [TaxId:167879] [189235] (1 PDB entry)
  8. 1907274Domain d3lo3z_: 3lo3 Z: [180461]
    automated match to d2fiua1
    complexed with gol

Details for d3lo3z_

PDB Entry: 3lo3 (more details), 2.38 Å

PDB Description: The crystal structure of a conserved functionally unknown protein from Colwellia psychrerythraea 34H.
PDB Compounds: (Z:) uncharacterized conserved protein

SCOPe Domain Sequences for d3lo3z_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lo3z_ d.58.4.0 (Z:) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

SCOPe Domain Coordinates for d3lo3z_:

Click to download the PDB-style file with coordinates for d3lo3z_.
(The format of our PDB-style files is described here.)

Timeline for d3lo3z_: