Lineage for d3lo3o_ (3lo3 O:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1204251Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1204576Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 1204577Protein automated matches [190081] (7 species)
    not a true protein
  7. 1204589Species Colwellia psychrerythraea [TaxId:167879] [189235] (1 PDB entry)
  8. 1204604Domain d3lo3o_: 3lo3 O: [180450]
    automated match to d2fiua1
    complexed with gol

Details for d3lo3o_

PDB Entry: 3lo3 (more details), 2.38 Å

PDB Description: The crystal structure of a conserved functionally unknown protein from Colwellia psychrerythraea 34H.
PDB Compounds: (O:) uncharacterized conserved protein

SCOPe Domain Sequences for d3lo3o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lo3o_ d.58.4.0 (O:) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef
psredaynwyhseeyqalistrdlgmdsqfqlig

SCOPe Domain Coordinates for d3lo3o_:

Click to download the PDB-style file with coordinates for d3lo3o_.
(The format of our PDB-style files is described here.)

Timeline for d3lo3o_: