Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.0: automated matches [191316] (1 protein) not a true family |
Protein automated matches [190081] (17 species) not a true protein |
Species Colwellia psychrerythraea [TaxId:167879] [189235] (1 PDB entry) |
Domain d3lo3f_: 3lo3 F: [180441] automated match to d2fiua1 complexed with gol |
PDB Entry: 3lo3 (more details), 2.38 Å
SCOPe Domain Sequences for d3lo3f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lo3f_ d.58.4.0 (F:) automated matches {Colwellia psychrerythraea [TaxId: 167879]} snatayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilef psredaynwyhseeyqalistrdlgmdsqfqlig
Timeline for d3lo3f_: