SCOPe 2.08: Domain d3lo3b1: 3lo3 B:2-92

Lineage for d3lo3b1 (3lo3 B:2-92)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Colwellia psychrerythraea [TaxId:167879] [189235] (1 PDB entry)

8. Domain d3lo3b1: 3lo3 B:2-92 [180437]
   Other proteins in same PDB: d3lo3a2, d3lo3b2, d3lo3c2, d3lo3d2, d3lo3e2, d3lo3f2, d3lo3g2, d3lo3h2, d3lo3i2, d3lo3j2, d3lo3k2, d3lo3l2, d3lo3m2, d3lo3n2, d3lo3o2, d3lo3p2, d3lo3q2, d3lo3r2, d3lo3s2, d3lo3t2, d3lo3u2, d3lo3v2, d3lo3w2, d3lo3x2, d3lo3y2, d3lo3z2
   automated match to d2fiua1
   complexed with gol

Details for d3lo3b1

PDB Entry: 3lo3, 2.38 Å

PDB Description: The crystal structure of a conserved functionally unknown protein from Colwellia psychrerythraea 34H.

PDB Compounds: (B:) uncharacterized conserved protein

SCOPe Domain Sequences for d3lo3b1:

Sequence; same for both SEQRES and ATOM records:

>d3lo3b1 d.58.4.0 (B:2-92) automated matches {Colwellia psychrerythraea [TaxId: 167879]}
tayiivgltpkdaeklqqygarvastlakysgevlvkgsveqlhgkfehkaqvilefpsr
edaynwyhseeyqalistrdlgmdsqfqlig

Timeline for d3lo3b1:

• d3lo3b1 first appeared in SCOPe 2.01, called d3lo3b_
  
• d3lo3b1 appears in SCOPe 2.07