| Class b: All beta proteins [48724] (180 folds) |
| Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
| Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
| Protein Phosphatase hPTP1e [50168] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50169] (9 PDB entries) |
| Domain d3lnxb_: 3lnx B: [180430] automated match to d1d5ga_ complexed with iod, scn |
PDB Entry: 3lnx (more details), 1.64 Å
SCOPe Domain Sequences for d3lnxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lnxb_ b.36.1.1 (B:) Phosphatase hPTP1e {Human (Homo sapiens) [TaxId: 9606]}
pkpgdifevelakndnslgisvtggvntsvrhggiyvkavipqgaaesdgrihkgdrvla
vngvslegathkqavetlrntgqvvhlllekgqs
Timeline for d3lnxb_: