SCOPe 2.01: Domain d3lntb_: 3lnt B:

Lineage for d3lntb_ (3lnt B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest

4. Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families)

5. Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)

6. Protein automated matches [190196] (7 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:320372] [188661] (3 PDB entries)

8. Domain d3lntb_: 3lnt B: [180425]
   automated match to d1e59a_
   complexed with edo, mli, na

Details for d3lntb_

PDB Entry: 3lnt, 2.1 Å

PDB Description: Crystal structure of phosphoglyceromutase from Burkholderia Pseudomallei 1710B with bound malonic acid

PDB Compounds: (B:) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase

SCOPe Domain Sequences for d3lntb_:

Sequence; same for both SEQRES and ATOM records:

>d3lntb_ c.60.1.1 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
myklvlirhgestwnkenrftgwvdvdlteqgnrearqagqllkeagytfdiaytsvlkr
airtlwhvqdqmdlmyvpvvhswrlnerhygalsglnkaetaakygdeqvlvwrrsydtp
ppalepgderapyadpryakvpreqlplteclkdtvarvlplwnesiapavkagkqvlia
ahgnslralikyldgisdadivglnipngvplvyeldesltpirhyylg

Timeline for d3lntb_:

• d3lntb_ is new in SCOPe 2.01-stable
  
• d3lntb_ appears in SCOPe 2.02
  
• d3lntb_ appears in the current release, SCOPe 2.08