SCOPe 2.08: Domain d3lnoe1: 3lno E:1-104

Lineage for d3lnoe1 (3lno E:1-104)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families)
   similar putative active site with a conserved cysteine residue

5. Family d.52.8.0: automated matches [191619] (1 protein)
   not a true family

6. Protein automated matches [191134] (3 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [189234] (1 PDB entry)

8. Domain d3lnoe1: 3lno E:1-104 [180421]
   Other proteins in same PDB: d3lnoa2, d3lnob2, d3lnoc2, d3lnod2, d3lnoe2, d3lnof2
   automated match to d1uwda_

Details for d3lnoe1

PDB Entry: 3lno, 2.1 Å

PDB Description: Crystal Structure of Domain of Unknown Function DUF59 from Bacillus anthracis

PDB Compounds: (E:) Putative uncharacterized protein

SCOPe Domain Sequences for d3lnoe1:

Sequence; same for both SEQRES and ATOM records:

>d3lnoe1 d.52.8.0 (E:1-104) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
msqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpmagqi
vsdvkkvlstnvpevneievnvvwnppwskermsrmakialgir

Timeline for d3lnoe1:

• d3lnoe1 first appeared in SCOPe 2.01, called d3lnoe_
  
• d3lnoe1 appears in SCOPe 2.07