Lineage for d3lnod_ (3lno D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412407Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 1412576Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) (S)
    similar putative active site with a conserved cysteine residue
  5. 1412608Family d.52.8.0: automated matches [191619] (1 protein)
    not a true family
  6. 1412609Protein automated matches [191134] (1 species)
    not a true protein
  7. 1412610Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [189234] (1 PDB entry)
  8. 1412614Domain d3lnod_: 3lno D: [180420]
    automated match to d1uwda_

Details for d3lnod_

PDB Entry: 3lno (more details), 2.1 Å

PDB Description: Crystal Structure of Domain of Unknown Function DUF59 from Bacillus anthracis
PDB Compounds: (D:) Putative uncharacterized protein

SCOPe Domain Sequences for d3lnod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lnod_ d.52.8.0 (D:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
snamsqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpma
gqivsdvkkvlstnvpevneievnvvwnppwskermsrmakialgir

SCOPe Domain Coordinates for d3lnod_:

Click to download the PDB-style file with coordinates for d3lnod_.
(The format of our PDB-style files is described here.)

Timeline for d3lnod_: