| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families) ![]() similar putative active site with a conserved cysteine residue |
| Family d.52.8.0: automated matches [191619] (1 protein) not a true family |
| Protein automated matches [191134] (3 species) not a true protein |
| Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [189234] (1 PDB entry) |
| Domain d3lnob_: 3lno B: [180418] automated match to d1uwda_ |
PDB Entry: 3lno (more details), 2.1 Å
SCOPe Domain Sequences for d3lnob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lnob_ d.52.8.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
namsqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpmag
qivsdvkkvlstnvpevneievnvvwnppwskermsrmakialgird
Timeline for d3lnob_: