SCOPe 2.05: Domain d3lnoa_: 3lno A:

Lineage for d3lnoa_ (3lno A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.8: Fe-S cluster assembly (FSCA) domain-like [117916] (3 families)
   similar putative active site with a conserved cysteine residue

5. Family d.52.8.0: automated matches [191619] (1 protein)
   not a true family

6. Protein automated matches [191134] (3 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [189234] (1 PDB entry)

8. Domain d3lnoa_: 3lno A: [180417]
   automated match to d1uwda_

Details for d3lnoa_

PDB Entry: 3lno, 2.1 Å

PDB Description: Crystal Structure of Domain of Unknown Function DUF59 from Bacillus anthracis

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3lnoa_:

Sequence; same for both SEQRES and ATOM records:

>d3lnoa_ d.52.8.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
namsqeafenklyanleavidpelgvdivnlglvydvtadennnavitmtmtsigcpmag
qivsdvkkvlstnvpevneievnvvwnppwskermsrmakialgir

Timeline for d3lnoa_:

• d3lnoa_ first appeared in SCOPe 2.01
  
• d3lnoa_ appears in SCOPe 2.04
  
• d3lnoa_ is called d3lnoa1 in SCOPe 2.06
  
• d3lnoa_ appears in the current release, SCOPe 2.08, called d3lnoa1