Lineage for d3lnlb1 (3lnl B:5-370)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151827Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily)
    consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest
  4. 2151828Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (2 families) (S)
    di-iron binding protein
  5. 2151854Family c.135.1.0: automated matches [191472] (1 protein)
    not a true family
  6. 2151855Protein automated matches [190747] (3 species)
    not a true protein
  7. 2151908Species Staphylococcus aureus [TaxId:158879] [187935] (2 PDB entries)
  8. 2151910Domain d3lnlb1: 3lnl B:5-370 [180414]
    Other proteins in same PDB: d3lnla2, d3lnlb2
    automated match to d2gx8a1
    complexed with b3p, zn

Details for d3lnlb1

PDB Entry: 3lnl (more details), 2 Å

PDB Description: crystal structure of staphylococcus aureus protein sa1388
PDB Compounds: (B:) UPF0135 protein SA1388

SCOPe Domain Sequences for d3lnlb1:

Sequence, based on SEQRES records: (download)

>d3lnlb1 c.135.1.0 (B:5-370) automated matches {Staphylococcus aureus [TaxId: 158879]}
mkiadlmtlldhhvpfstaeswdnvglligdedvevtgvltaldctlevvneaiekgynt
iishhplifkgvtslkangygliirkliqhdinliamhtnldvnphgvnmmlakvmglkn
isiinnqqdvyykvqtyipkdnvgpfkdklsenglaqegnyeycffesegrgqfkpvgea
nptigqidkiedvdevkiefmidayqksraeqlikqyhpyetpvfdfieikqtslyglgv
maevdnqmtledfaadiksklnipsvrfvgesnqkikriaiiggsgigyeyqavqqgadv
fvtgdikhhdaldakihgvnlidinhyseyvmkeglktllmnwfniekinidveastint
dpfqyi

Sequence, based on observed residues (ATOM records): (download)

>d3lnlb1 c.135.1.0 (B:5-370) automated matches {Staphylococcus aureus [TaxId: 158879]}
mkiadlmtlldhhvpfstaeswdnvglligdedvevtgvltaldctlevvneaiekgynt
iishhplifkgvtslkangygliirkliqhdinliamhtnldvnphgvnmmlakvmglkn
isiinnqqdvyykvqtyipkdnvgpfkdklsenglaqeycffesegrgqedvdevkiefm
idayqksraeqlikqyhpyetpvfdfieikqtslyglgvmaevdnqmtledfaadikskl
nipsvrfvgesnqkikriaiiggsgigyeyqavqqgadvfvtgdikhhdaldakihgvnl
idinhyseyvmkeglktllmnwfniekinidveastintdpfqyi

SCOPe Domain Coordinates for d3lnlb1:

Click to download the PDB-style file with coordinates for d3lnlb1.
(The format of our PDB-style files is described here.)

Timeline for d3lnlb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lnlb2