Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.135: NIF3 (NGG1p interacting factor 3)-like [102704] (1 superfamily) consist of two intertwined domains; duplication: contains two structural repeats of alpha-beta-(beta-alpha)3 motif with mixed beta-sheet, order: 1432, strand 1 is antiparallel to the rest |
Superfamily c.135.1: NIF3 (NGG1p interacting factor 3)-like [102705] (2 families) di-iron binding protein |
Family c.135.1.0: automated matches [191472] (1 protein) not a true family |
Protein automated matches [190747] (2 species) not a true protein |
Species Staphylococcus aureus [TaxId:158879] [187935] (2 PDB entries) |
Domain d3lnla_: 3lnl A: [180413] automated match to d2gx8a1 complexed with b3p, zn |
PDB Entry: 3lnl (more details), 2 Å
SCOPe Domain Sequences for d3lnla_:
Sequence, based on SEQRES records: (download)
>d3lnla_ c.135.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]} dpmkiadlmtlldhhvpfstaeswdnvglligdedvevtgvltaldctlevvneaiekgy ntiishhplifkgvtslkangygliirkliqhdinliamhtnldvnphgvnmmlakvmgl knisiinnqqdvyykvqtyipkdnvgpfkdklsenglaqegnyeycffesegrgqfkpvg eanptigqidkiedvdevkiefmidayqksraeqlikqyhpyetpvfdfieikqtslygl gvmaevdnqmtledfaadiksklnipsvrfvgesnqkikriaiiggsgigyeyqavqqga dvfvtgdikhhdaldakihgvnlidinhyseyvmkeglktllmnwfniekinidveasti ntdpfqyi
>d3lnla_ c.135.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158879]} dpmkiadlmtlldhhvpfstaeswdnvglligdedvevtgvltaldctlevvneaiekgy ntiishhplifkgvtslkangygliirkliqhdinliamhtnldvnphgvnmmlakvmgl knisiinnqqdvyykvqkiefmidayqksraeqlikqyhpyetpvfdfieikqtslyglg vmaevdnqmtledfaadiksklnipsvrfvgesnqkikriaiiggsgigyeyqavqqgad vfvtgdikhhdaldakihgvnlidinhyseyvmkeglktllmnwfniekinidveastin tdpfqyi
Timeline for d3lnla_: