SCOPe 2.05: Domain d3lmxo_: 3lmx O:

Lineage for d3lmxo_ (3lmx O:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)

7. Species Pseudomonas putida [TaxId:303] [49490] (36 PDB entries)

8. Domain d3lmxo_: 3lmx O: [180403]
   Other proteins in same PDB: d3lmxa_, d3lmxb_, d3lmxc_
   automated match to d1ykkb1
   complexed with bme, cl, dhb, fe, gol, so4

Details for d3lmxo_

PDB Entry: 3lmx, 2.2 Å

PDB Description: tyrosine 447 of protocatechuate 34,-dioxygenase controls efficient progress through catalysis

PDB Compounds: (O:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d3lmxo_:

Sequence; same for both SEQRES and ATOM records:

>d3lmxo_ b.3.6.1 (O:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgphpwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfenc

Timeline for d3lmxo_:

• d3lmxo_ first appeared in SCOPe 2.01
  
• d3lmxo_ appears in SCOPe 2.04
  
• d3lmxo_ appears in SCOPe 2.06
  
• d3lmxo_ appears in the current release, SCOPe 2.08