Lineage for d3lmkb_ (3lmk B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143710Family c.93.1.1: L-arabinose binding protein-like [53823] (18 protein domains)
  6. 2143939Protein automated matches [190296] (11 species)
    not a true protein
  7. 2143963Species Human (Homo sapiens) [TaxId:9606] [189164] (3 PDB entries)
  8. 2143968Domain d3lmkb_: 3lmk B: [180394]
    automated match to d1ewkb_
    complexed with glu, mg, nag

Details for d3lmkb_

PDB Entry: 3lmk (more details), 2.44 Å

PDB Description: ligand binding domain of metabotropoc glutamate receptor mglur5 complexed with glutamate
PDB Compounds: (B:) Metabotropic glutamate receptor 5

SCOPe Domain Sequences for d3lmkb_:

Sequence, based on SEQRES records: (download)

>d3lmkb_ c.93.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvvahmpgdiiigalfsvhhqptvdkvherkcgavreqygiqrveamlhtlerinsdptl
lpnitlgceirdscwhsavaleqsiefirdslisseeeeglvrcvdgssssfrskkpivg
vigpgsssvaiqvqnllqlfnipqiaysatsmdlsdktlfkyfmrvvpsdaqqaramvdi
vkrynwtyvsavhtegnygesgmeafkdmsakegisiahsykiysnageqsfdkllkklt
shlpkarvvacfcegmtvrgllmamrrlglageflllgsdgwadrydvtdgyqreavggi
tiklqspdvkwfddyylklrpetnhrnpwfqefwqhrfqcrlegfpqenskynktcnssl
tlkthhvqdskmgfvinaiysmayglhnmqmslcpgyaglcdamkpidgrklleslmktn
ftgvsgdtilfdengdspgryeimnfkemgkdyfdyinvgswdngelkmd

Sequence, based on observed residues (ATOM records): (download)

>d3lmkb_ c.93.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rvvahmpgdiiigalfsvhhqptvdkvherkcgavreqygiqrveamlhtlerinsdptl
lpnitlgceirdscwhsavaleqsiefirdkpivgvigpgsssvaiqvqnllqlfnipqi
aysatsmdlsdktlfkyfmrvvpsdaqqaramvdivkrynwtyvsavhtegnygesgmea
fkdmsakegisiahsykiysnageqsfdkllkkltshlpkarvvacfcegmtvrgllmam
rrlglageflllgsdgwadrydvtdgyqreavggitiklqspdvkwfddyylklrpetnh
rnpwfqefwqhrfqcrlegkynktcnssltlkthhvqdskmgfvinaiysmayglhnmqm
slcpgyaglcdamkpidgrklleslmktnftgvsgdtilfdengdspgryeimnfkemgk
dyfdyinvgswdngelkmd

SCOPe Domain Coordinates for d3lmkb_:

Click to download the PDB-style file with coordinates for d3lmkb_.
(The format of our PDB-style files is described here.)

Timeline for d3lmkb_: