Lineage for d3lmeg1 (3lme G:30-156)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958881Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2958882Protein automated matches [190935] (24 species)
    not a true protein
  7. 2959034Species Rhodopseudomonas palustris [TaxId:1076] [189252] (1 PDB entry)
  8. 2959041Domain d3lmeg1: 3lme G:30-156 [180387]
    Other proteins in same PDB: d3lmea2, d3lmeb2, d3lmec2, d3lmed2, d3lmee2, d3lmef2, d3lmeg2, d3lmeh2, d3lmei2, d3lmej2, d3lmek2, d3lmel2
    automated match to d2cwja1
    complexed with so4

Details for d3lmeg1

PDB Entry: 3lme (more details), 2.74 Å

PDB Description: structure of probable translation initiation inhibitor from (rpa2473) from rhodopseudomonas palustris
PDB Compounds: (G:) Possible translation initiation inhibitor

SCOPe Domain Sequences for d3lmeg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lmeg1 d.79.1.0 (G:30-156) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
kiiaptdktitpsgtwsigaragdfvfiggmhgtdrvtgkmvdgdearirrmfdnmlaaa
eaagatkadavrltvfvtdvakyrpvvnkvqkdiwgdgpypprtvlqvpaldqgdiaeid
gtfyapa

SCOPe Domain Coordinates for d3lmeg1:

Click to download the PDB-style file with coordinates for d3lmeg1.
(The format of our PDB-style files is described here.)

Timeline for d3lmeg1: