| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.1: YjgF-like [55298] (4 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
| Family d.79.1.0: automated matches [191544] (1 protein) not a true family |
| Protein automated matches [190935] (24 species) not a true protein |
| Species Rhodopseudomonas palustris [TaxId:1076] [189252] (1 PDB entry) |
| Domain d3lmeg1: 3lme G:30-156 [180387] Other proteins in same PDB: d3lmea2, d3lmeb2, d3lmec2, d3lmed2, d3lmee2, d3lmef2, d3lmeg2, d3lmeh2, d3lmei2, d3lmej2, d3lmek2, d3lmel2 automated match to d2cwja1 complexed with so4 |
PDB Entry: 3lme (more details), 2.74 Å
SCOPe Domain Sequences for d3lmeg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lmeg1 d.79.1.0 (G:30-156) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
kiiaptdktitpsgtwsigaragdfvfiggmhgtdrvtgkmvdgdearirrmfdnmlaaa
eaagatkadavrltvfvtdvakyrpvvnkvqkdiwgdgpypprtvlqvpaldqgdiaeid
gtfyapa
Timeline for d3lmeg1: