Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.0: automated matches [191625] (1 protein) not a true family |
Protein automated matches [191144] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189286] (21 PDB entries) |
Domain d3llra_: 3llr A: [180374] automated match to d1khca_ complexed with btb, so4 |
PDB Entry: 3llr (more details), 2.3 Å
SCOPe Domain Sequences for d3llra_:
Sequence, based on SEQRES records: (download)
>d3llra_ b.34.9.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eyedgrgfgigelvwgklrgfswwpgrivswwmtgrsraaegtrwvmwfgdgkfsvvcve klmplssfcsafhqatynkqpmyrkaiyevlqvassragklfpvchdsdesdtakavevq nkpmiewalggfqpsgpkglepp
>d3llra_ b.34.9.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eyedgrgfgigelvwgklrgfswwpgrivswwmtgrsraaegtrwvmwfgdgkfsvvcve klmplssfcsafhqatynkqpmyrkaiyevlqvassragklfpavevqnkpmiewalggf qpsgpkglepp
Timeline for d3llra_:
View in 3D Domains from other chains: (mouse over for more information) d3llrb_, d3llrc_, d3llrd_, d3llre_ |