Lineage for d3lkjc_ (3lkj C:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117451Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1117452Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1117453Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1117692Protein automated matches [190204] (3 species)
    not a true protein
  7. 1117693Species Human (Homo sapiens) [TaxId:9606] [186956] (8 PDB entries)
  8. 1117704Domain d3lkjc_: 3lkj C: [180348]
    automated match to d1alya_
    complexed with lkj, nag

Details for d3lkjc_

PDB Entry: 3lkj (more details), 2.5 Å

PDB Description: Small Molecule Inhibition of the TNF Family Cyokine CD40 Ligand Through a Subunit Fracture Mechanism
PDB Compounds: (C:) cd40 ligand

SCOPe Domain Sequences for d3lkjc_:

Sequence, based on SEQRES records: (download)

>d3lkjc_ b.22.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfcsn
reassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvfvn
vtdpsqvshgtgftsfgllkl

Sequence, based on observed residues (ATOM records): (download)

>d3lkjc_ b.22.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfcsn
pfiaslclkspgrferillraantpcgqqsihlggvfelqpgasvfvnvtdpsqvshgtg
ftsfgllkl

SCOPe Domain Coordinates for d3lkjc_:

Click to download the PDB-style file with coordinates for d3lkjc_.
(The format of our PDB-style files is described here.)

Timeline for d3lkjc_: