SCOPe 2.05: Domain d3lkjb_: 3lkj B:

Lineage for d3lkjb_ (3lkj B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein automated matches [190204] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186956] (9 PDB entries)

8. Domain d3lkjb_: 3lkj B: [180347]
   automated match to d1alya_
   complexed with lkj, nag

Details for d3lkjb_

PDB Entry: 3lkj, 2.5 Å

PDB Description: small molecule inhibition of the tnf family cyokine cd40 ligand through a subunit fracture mechanism

PDB Compounds: (B:) cd40 ligand

SCOPe Domain Sequences for d3lkjb_:

Sequence, based on SEQRES records:

>d3lkjb_ b.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfcsn
reassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvfvn
vtdpsqvshgtgftsfgllkl

Sequence, based on observed residues (ATOM records):

>d3lkjb_ b.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qiaahviseastsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfcsnapf
iaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvfvnvtdpsqvsh
gtgftsfgllkl

Timeline for d3lkjb_:

• d3lkjb_ first appeared in SCOPe 2.01
  
• d3lkjb_ appears in SCOPe 2.04
  
• d3lkjb_ appears in SCOPe 2.06
  
• d3lkjb_ appears in the current release, SCOPe 2.08