Lineage for d3lkja_ (3lkj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777555Protein automated matches [190204] (3 species)
    not a true protein
  7. 2777556Species Human (Homo sapiens) [TaxId:9606] [186956] (13 PDB entries)
  8. 2777572Domain d3lkja_: 3lkj A: [180346]
    automated match to d1alya_
    complexed with lkj, nag

Details for d3lkja_

PDB Entry: 3lkj (more details), 2.5 Å

PDB Description: small molecule inhibition of the tnf family cyokine cd40 ligand through a subunit fracture mechanism
PDB Compounds: (A:) cd40 ligand

SCOPe Domain Sequences for d3lkja_:

Sequence, based on SEQRES records: (download)

>d3lkja_ b.22.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfcsn
reassqapfiaslclkspgrferillraanthssakpcgqqsihlggvfelqpgasvfvn
vtdpsqvshgtgftsfgllkl

Sequence, based on observed residues (ATOM records): (download)

>d3lkja_ b.22.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qiaahviseasskttsvlqwaekgyytmsnnlvtlengkqltvkrqglyyiyaqvtfcas
sqapfiaslclkspgrferillraantkpcgqqsihlggvfelqpgasvfvnvtdpsqvs
hgtgftsfgllkl

SCOPe Domain Coordinates for d3lkja_:

Click to download the PDB-style file with coordinates for d3lkja_.
(The format of our PDB-style files is described here.)

Timeline for d3lkja_: