SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3ljsa1 (3ljs A:12-338)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (40 species)
    not a true protein
  7. 2137970Species Xylella fastidiosa [TaxId:183190] [189265] (2 PDB entries)
  8. 2137971Domain d3ljsa1: 3ljs A:12-338 [180328]
    Other proteins in same PDB: d3ljsa2, d3ljsb2
    automated match to d1tyyb_
    complexed with po4

Details for d3ljsa1

PDB Entry: 3ljs (more details), 1.97 Å

PDB Description: Crystal structure of Fructokinase from Xylella fastidiosa
PDB Compounds: (A:) fructokinase

SCOPe Domain Sequences for d3ljsa1:

Sequence, based on SEQRES records: (download)

>d3ljsa1 c.72.1.0 (A:12-338) automated matches {Xylella fastidiosa [TaxId: 183190]}
kktilcfgealidmlaqplvkkgmpraflqcaggapanvavavarlggavqfvgmlgsdm
fgdflfdsfaeagvvtdgivrtstaktalafvaldahgersfsfyrppaadllfrvehfq
dasfsdalifhacsnsmtdadiaevtfegmrraqaagaivsfdlnfrpmlwpngenpasr
lwkglsladvvklsseeldylantlaadanaviqqlwqgraqlllvtdaagpvhwytrta
ggevptfrvqvqdsnaagdafvggmlytfaqqfddaaalidfchdpesivstlrfaaavg
alavtrqgaftampmlsevlsliqeqs

Sequence, based on observed residues (ATOM records): (download)

>d3ljsa1 c.72.1.0 (A:12-338) automated matches {Xylella fastidiosa [TaxId: 183190]}
kktilcfgealidmlaqplvkkgmpraflqcaggapanvavavarlggavqfvgmlgsdm
fgdflfdsfaeagvvtdgivrtstaktalafvaldahgersfsfyrppaadllfrvehfq
dasfsdalifhacsnsmtdadiaevtfegmrraqaagaivsfdlnfrpmlwpngenpasr
lwkglsladvvklsseeldylantlaadanaviqqlwqgraqlllvtdaagpvhwytrta
ggevptgdafvggmlytfaqqfddaaalidfchdpesivstlrfaaavgalavaftampm
lsevlsliqeqs

SCOPe Domain Coordinates for d3ljsa1:

Click to download the PDB-style file with coordinates for d3ljsa1.
(The format of our PDB-style files is described here.)

Timeline for d3ljsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ljsa2