Lineage for d3ljsa1 (3ljs A:12-338)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137471Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2137472Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2137707Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2137708Protein automated matches [190117] (39 species)
    not a true protein
  7. 2137970Species Xylella fastidiosa [TaxId:183190] [189265] (2 PDB entries)
  8. 2137971Domain d3ljsa1: 3ljs A:12-338 [180328]
    Other proteins in same PDB: d3ljsa2, d3ljsb2
    automated match to d1tyyb_
    complexed with po4

Details for d3ljsa1

PDB Entry: 3ljs (more details), 1.97 Å

PDB Description: Crystal structure of Fructokinase from Xylella fastidiosa
PDB Compounds: (A:) fructokinase

SCOPe Domain Sequences for d3ljsa1:

Sequence, based on SEQRES records: (download)

>d3ljsa1 c.72.1.0 (A:12-338) automated matches {Xylella fastidiosa [TaxId: 183190]}
kktilcfgealidmlaqplvkkgmpraflqcaggapanvavavarlggavqfvgmlgsdm
fgdflfdsfaeagvvtdgivrtstaktalafvaldahgersfsfyrppaadllfrvehfq
dasfsdalifhacsnsmtdadiaevtfegmrraqaagaivsfdlnfrpmlwpngenpasr
lwkglsladvvklsseeldylantlaadanaviqqlwqgraqlllvtdaagpvhwytrta
ggevptfrvqvqdsnaagdafvggmlytfaqqfddaaalidfchdpesivstlrfaaavg
alavtrqgaftampmlsevlsliqeqs

Sequence, based on observed residues (ATOM records): (download)

>d3ljsa1 c.72.1.0 (A:12-338) automated matches {Xylella fastidiosa [TaxId: 183190]}
kktilcfgealidmlaqplvkkgmpraflqcaggapanvavavarlggavqfvgmlgsdm
fgdflfdsfaeagvvtdgivrtstaktalafvaldahgersfsfyrppaadllfrvehfq
dasfsdalifhacsnsmtdadiaevtfegmrraqaagaivsfdlnfrpmlwpngenpasr
lwkglsladvvklsseeldylantlaadanaviqqlwqgraqlllvtdaagpvhwytrta
ggevptgdafvggmlytfaqqfddaaalidfchdpesivstlrfaaavgalavaftampm
lsevlsliqeqs

SCOPe Domain Coordinates for d3ljsa1:

Click to download the PDB-style file with coordinates for d3ljsa1.
(The format of our PDB-style files is described here.)

Timeline for d3ljsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ljsa2