Lineage for d3ljja_ (3ljj A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 953999Protein Trypsin(ogen) [50515] (9 species)
  7. 954017Species Cow (Bos taurus) [TaxId:9913] [50516] (340 PDB entries)
    Uniprot P00760
  8. 954212Domain d3ljja_: 3ljj A: [180324]
    automated match to d1aq7a_
    complexed with 10u, ca, so4

Details for d3ljja_

PDB Entry: 3ljj (more details), 1.55 Å

PDB Description: bovine trypsin in complex with ub-thr 10
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d3ljja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ljja_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d3ljja_:

Click to download the PDB-style file with coordinates for d3ljja_.
(The format of our PDB-style files is described here.)

Timeline for d3ljja_: