Lineage for d3ljga1 (3ljg A:106-263)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2204982Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2204983Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2205557Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2205733Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2205734Species Human (Homo sapiens) [TaxId:9606] [69781] (39 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 2205740Domain d3ljga1: 3ljg A:106-263 [180323]
    Other proteins in same PDB: d3ljga2
    automated match to d1os2a_
    complexed with ca, eef, hae, p6g, zn

Details for d3ljga1

PDB Entry: 3ljg (more details), 1.31 Å

PDB Description: human mmp12 in complex with non-zinc chelating inhibitor
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d3ljga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ljga1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d3ljga1:

Click to download the PDB-style file with coordinates for d3ljga1.
(The format of our PDB-style files is described here.)

Timeline for d3ljga1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ljga2