Lineage for d3ljea_ (3lje A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2498373Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2498374Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2498974Family d.5.1.0: automated matches [191478] (1 protein)
    not a true family
  6. 2498975Protein automated matches [190767] (6 species)
    not a true protein
  7. 2498989Species Zebrafish (Danio rerio) [TaxId:7955] [188473] (5 PDB entries)
  8. 2498995Domain d3ljea_: 3lje A: [180322]
    automated match to d1un5a_
    complexed with act, so4

Details for d3ljea_

PDB Entry: 3lje (more details), 1.8 Å

PDB Description: The X-ray structure of zebrafish RNase5
PDB Compounds: (A:) Zebrafish RNase5

SCOPe Domain Sequences for d3ljea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ljea_ d.5.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
kvppdvdpryqkflrqhvdadmsvqkcdramsikkitagtgndckevntfiqatkdritt
vcgdagtpvnnlfksnqpfpvvtcklksgnrrpncqyrgtsstryivlgcdkgwpvhyde
g

SCOPe Domain Coordinates for d3ljea_:

Click to download the PDB-style file with coordinates for d3ljea_.
(The format of our PDB-style files is described here.)

Timeline for d3ljea_: